PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA011583-PA
Common NameOsI_09711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 114aa    MW: 11765 Da    PI: 4.6997
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA011583-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix41.53.6e-136196136
          trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevsk 36
                      rW++qe+laL+++r+em+ ++r+++lk+plWeevs+
  BGIOSGA011583-PA 61 RWPRQETLALLKIRSEMDAAFREAALKGPLWEEVSR 96
                      8**********************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MPPFSAAGGE GAPSPISSRP PPPEQAAAAA AEEQLNGSSL EHDGVLGGEE GDRGGSSAGN  60
RWPRQETLAL LKIRSEMDAA FREAALKGPL WEEVSRSDVI KHAASIPSPT IPKG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.395761e-162flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976002281e-162
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1214901e-159AC121490.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBb0005F16, complete sequence.
GenBankAC1342371e-159AC134237.2 Oryza sativa Japonica Group chromosome 3 clone OSJNBa0090O10, complete sequence.
GenBankAK2418001e-159AK241800.1 Oryza sativa Japonica Group cDNA, clone: J065208I24, full insert sequence.
GenBankAP0149591e-159AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628078.11e-56PREDICTED: trihelix transcription factor GTL1
TrEMBLA2XBP94e-75A2XBP9_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA011583-PA1e-74(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP152231218
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-16Trihelix family protein